Mouse Sdf2l1 protein

Artikelnummer: BYT-ORB383418
Artikelname: Mouse Sdf2l1 protein
Artikelnummer: BYT-ORB383418
Hersteller Artikelnummer: orb383418
Alternativnummer: BYT-ORB383418-20,BYT-ORB383418-100,BYT-ORB383418-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Sdf2l1, Stromal cell-derived factor 2-like protein 1, SDF2-like protein 1
This Mouse Sdf2l1 protein spans the amino acid sequence from region 29-211aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 24.4 kDa
UniProt: Q9ESP1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.