A27L protein

Artikelnummer: BYT-ORB383445
Artikelname: A27L protein
Artikelnummer: BYT-ORB383445
Hersteller Artikelnummer: orb383445
Alternativnummer: BYT-ORB383445-20,BYT-ORB383445-100,BYT-ORB383445-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: A27L, A30L14 kDa fusion protein
This A27L protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 15.0 kDa
UniProt: P33816
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Smallpox virus
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Anwendungsbeschreibung: Biological Origin: Smallpox virus. Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.