Amphibians SAX protein

Artikelnummer: BYT-ORB383454
Artikelname: Amphibians SAX protein
Artikelnummer: BYT-ORB383454
Hersteller Artikelnummer: orb383454
Alternativnummer: BYT-ORB383454-20,BYT-ORB383454-100,BYT-ORB383454-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: SAX
This Amphibians SAX protein spans the amino acid sequence from region 484-844aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 43.7 kDa
UniProt: P31226
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKS
Anwendungsbeschreibung: Biological Origin: Lithobates catesbeiana (American bullfrog) (Rana catesbeiana). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.