Pig HSP90AA1 protein

Artikelnummer: BYT-ORB383455
Artikelname: Pig HSP90AA1 protein
Artikelnummer: BYT-ORB383455
Hersteller Artikelnummer: orb383455
Alternativnummer: BYT-ORB383455-20,BYT-ORB383455-100,BYT-ORB383455-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: HSP90AA1, HSP90A, HSPCAHeat shock protein HSP 90-alpha
This Pig HSP90AA1 protein spans the amino acid sequence from region 222-367aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 19.7 kDa
UniProt: O02705
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Sus scrofa (Pig)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVR
Anwendungsbeschreibung: Biological Origin: Sus scrofa (Pig). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.