Mouse Masp2 protein

Artikelnummer: BYT-ORB383458
Artikelname: Mouse Masp2 protein
Artikelnummer: BYT-ORB383458
Hersteller Artikelnummer: orb383458
Alternativnummer: BYT-ORB383458-20,BYT-ORB383458-100,BYT-ORB383458-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 Short name, MASP-2
This Mouse Masp2 protein spans the amino acid sequence from region 20-685aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 75.4 kDa
UniProt: Q91WP0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SKWPEPVFGRLVSPGFPEKYADHQDRSWTLTAPPGYRLRLYFTHFDLELSYRCEYDFVKLSSGTKVLATLCGQESTDTEQAPGNDTFYSLGPSLKVTFHSDYSNEKPFTGFEAFYAAEDVDECRVSLGDSVPCDHYCHNYLGGYYCSCRAGYVLHQNKHTCSALCSGQVFTGRSGYLSSPEYPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQTDKGEHGPFCGKTLPPRIETDSHKV
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.