Bovine PAG1 protein

Artikelnummer: BYT-ORB383460
Artikelname: Bovine PAG1 protein
Artikelnummer: BYT-ORB383460
Hersteller Artikelnummer: orb383460
Alternativnummer: BYT-ORB383460-20,BYT-ORB383460-100,BYT-ORB383460-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Pregnancy-specific protein B Short name, PSP-B
This Bovine PAG1 protein spans the amino acid sequence from region 54-380aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 38.7 kDa
UniProt: Q29432
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Bos taurus (Bovine)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RGSNLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFRLTNKTFRITYGSGRMKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDKLKNQRAISEPVFAFYLSKDEREGSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCKALVDTGTSDIVGPRRLVNNIHRLIGAIPRGSEHYVPCSEVNT
Anwendungsbeschreibung: Biological Origin: Bos taurus (Bovine). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.