Rat Cfd protein

Artikelnummer: BYT-ORB383468
Artikelname: Rat Cfd protein
Artikelnummer: BYT-ORB383468
Hersteller Artikelnummer: orb383468
Alternativnummer: BYT-ORB383468-20,BYT-ORB383468-100,BYT-ORB383468-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D
This Rat Cfd protein spans the amino acid sequence from region 26-263aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 29.8 kDa
UniProt: P32038
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Baculovirus and Mammalian Cell N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.