Bacterial A673_03341 protein

Artikelnummer: BYT-ORB383470
Artikelname: Bacterial A673_03341 protein
Artikelnummer: BYT-ORB383470
Hersteller Artikelnummer: orb383470
Alternativnummer: BYT-ORB383470-20,BYT-ORB383470-100,BYT-ORB383470-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: /
This Bacterial A673_03341 protein spans the amino acid sequence from region 82-220aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 18.6 kDa
UniProt: S4JJH7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ
Anwendungsbeschreibung: Biological Origin: Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958. Application Notes: Baculovirus and Mammalian Cell N-terminal 10xHis-tagged and C-terminal Myc-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.