Human CAPN14 protein

Artikelnummer: BYT-ORB383471
Artikelname: Human CAPN14 protein
Artikelnummer: BYT-ORB383471
Hersteller Artikelnummer: orb383471
Alternativnummer: BYT-ORB383471-20,BYT-ORB383471-100,BYT-ORB383471-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Calcium-activated neutral proteinase 14
This Human CAPN14 protein spans the amino acid sequence from region 43-684aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 78.6 kDa
UniProt: A8MX76
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LFEDTSFPATLSSIGSGSLLQKLPPRLQWKRPPELHSNPQFYFAKAKRLDLCQGIVGDCWFLAALQALALHQDILSRVVPLNQSFTEKYAGIFRFWFWHYGNWVPVVIDDRLPVNEAGQLVFVSSTYKNLFWGALLEKAYAKLSGSYEDLQSGQVSEALVDFTGGVTMTINLAEAHGNLWDILIEATYNRTLIGCQTHSGEKILENGLVEGHAYTLTGIRKVTCKHRPEYLVKLRNPWGKVEWKGDWSDSSSKWE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Baculovirus and Mammalian Cell N-terminal 10xHis-tagged and C-terminal Myc-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.