Mouse VWF protein

Artikelnummer: BYT-ORB418689
Artikelname: Mouse VWF protein
Artikelnummer: BYT-ORB418689
Hersteller Artikelnummer: orb418689
Alternativnummer: BYT-ORB418689-20,BYT-ORB418689-100,BYT-ORB418689-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: von Willebrand antigen II
This Mouse VWF protein spans the amino acid sequence from region 1498-1665aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 23.9 kDa
UniProt: Q8CIZ8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1498-1665aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.