Bacterial hlb protein

Artikelnummer: BYT-ORB418697
Artikelname: Bacterial hlb protein
Artikelnummer: BYT-ORB418697
Hersteller Artikelnummer: orb418697
Alternativnummer: BYT-ORB418697-20,BYT-ORB418697-100,BYT-ORB418697-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Beta-hemolysin Beta-toxin Sphingomyelinase plc
This Bacterial hlb protein spans the amino acid sequence from region 35-330aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 35.7 kDa
UniProt: P09978
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Staphylococcus aureus (strain MRSA252)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ESKKDDTDLKLVSHNVYMLSTVLYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPEFKDMLKNLNVNDVLYAGHNSTWDPQSNSIAKYNYPNGKPEHLDYIFTDKDHKQ
Anwendungsbeschreibung: Biological Origin: Staphylococcus aureus (strain MRSA252). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 35-330aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.