Human SUMO2 Protein
Artikelnummer:
BYT-ORB428678
| Artikelname: |
Human SUMO2 Protein |
| Artikelnummer: |
BYT-ORB428678 |
| Hersteller Artikelnummer: |
orb428678 |
| Alternativnummer: |
BYT-ORB428678-1,BYT-ORB428678-10,BYT-ORB428678-50 |
| Hersteller: |
Biorbyt |
| Kategorie: |
Proteine/Peptide |
| Alternative Synonym: |
Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191. |
| Recombinant of human SUMO2 protein |
| Puffer: |
The SUMO2 (1mg/ml) containing 20mM Tris-HCl buffer (pH 8.0). |
| Reinheit: |
Greater than 95.0% as determined by SDS-PAGE. |
| Formulierung: |
Sterile filtered colorless solution. |
| Sequenz: |
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG |
| Anwendungsbeschreibung: |
Application Notes: Recombinant & Natural Proteins |
