Human TARC Protein

Artikelnummer: BYT-ORB428735
Artikelname: Human TARC Protein
Artikelnummer: BYT-ORB428735
Hersteller Artikelnummer: orb428735
Alternativnummer: BYT-ORB428735-1,BYT-ORB428735-20,BYT-ORB428735-5
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: C-C motif chemokine 17, Small-inducible cytokine A17, Thymus and activation-regulated chemokine, CC chemokine TARC, ABCD-2, CCL17, CCL-17, SCYA17, TARC, A-152E5.3, MGC138271, MGC138273.
Recombinant of human TARC protein
Puffer: The protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4.
Reinheit: Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS
Anwendungsbeschreibung: Solubility: It is recommended to reconstitute the lyophilized CCL17 in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg. Application Notes: Chemokines