Human KRT18 protein

Artikelnummer: BYT-ORB54090
Artikelname: Human KRT18 protein
Artikelnummer: BYT-ORB54090
Hersteller Artikelnummer: orb54090
Alternativnummer: BYT-ORB54090-20,BYT-ORB54090-100,BYT-ORB54090-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cell proliferation-inducing gene 46 protein, Cytokeratin-18 , CK-18Keratin-18 , K18
This Human KRT18 protein spans the amino acid sequence from region 11-430aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 50.9 kDa
UniProt: P05783
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNRE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal 6xHis-tagged11-375AA: 11-430AAPartial: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) KRT18.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) KRT18.