Insect Hirudo nipponia Guamerin protein
Artikelnummer:
BYT-ORB54158
- Bilder (3)
| Artikelname: | Insect Hirudo nipponia Guamerin protein |
| Artikelnummer: | BYT-ORB54158 |
| Hersteller Artikelnummer: | orb54158 |
| Alternativnummer: | BYT-ORB54158-20,BYT-ORB54158-100,BYT-ORB54158-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Guamerin |
| This Insect Hirudo nipponia Guamerin protein spans the amino acid sequence from region 1-57aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 8.1 kDa |
| UniProt: | P46443 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Hirudo nipponia (Korean blood-sucking leech) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | VDENAEDTHGLCGEKTCSPAQVCLNNECACTAIRCMIFCPNGFKVDENGCEYPCTCA |
| Anwendungsbeschreibung: | Biological Origin: Hirudo nipponia (Korean blood-sucking leech). Application Notes: N-terminal 10xHis-tagged: N-terminal 6xHis-tagged24-332AA: 1-57AAFull Length of Mature Protein: Full Length |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Hirudo nipponia (Korean blood-sucking leech) Guamerin. |
|
|
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Hirudo nipponia (Korean blood-sucking leech) Guamerin. |
Produktgarantie und fachkundiger Support
