Mouse Gpi protein
Artikelnummer:
BYT-ORB54160
- Bilder (3)
| Artikelname: | Mouse Gpi protein |
| Artikelnummer: | BYT-ORB54160 |
| Hersteller Artikelnummer: | orb54160 |
| Alternativnummer: | BYT-ORB54160-20,BYT-ORB54160-100,BYT-ORB54160-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Autocrine motility factor |
| This Mouse Gpi protein spans the amino acid sequence from region 2-558aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 76.6 kDa |
| UniProt: | P06745 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mus musculus (Mouse) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNNFSLNLNTNHGHILVDYSKNLVNKEVMQMLVELAKSRGVEAARDNMFSGSKINYTENRAVLHVALRNRSNTPIKVDGKDVMPEVNRVLDKMKSFCQRVRSGDWKGYTGKSITDIINIGIGGSDLGPLMVTEALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPETSLFIIASKTFTTQETITNAETAKEWFLEAAKDPSAVAKHFVALSTNTAKVKEF |
| Anwendungsbeschreibung: | Biological Origin: Mus musculus (Mouse). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-B2M-tagged1-47AA: 2-558AAFull Length: Full Length |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Gpi. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Gpi. |
Produktgarantie und fachkundiger Support
