Viral VP40 protein
Artikelnummer:
BYT-ORB54193
- Bilder (3)
| Artikelname: | Viral VP40 protein |
| Artikelnummer: | BYT-ORB54193 |
| Hersteller Artikelnummer: | orb54193 |
| Alternativnummer: | BYT-ORB54193-20,BYT-ORB54193-100,BYT-ORB54193-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Membrane-associated protein VP40 |
| This Viral VP40 protein spans the amino acid sequence from region 1-331aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 51.8 kDa |
| UniProt: | Q8JPX9 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Reston ebolavirus (strain Reston-89) (REBOV) (Reston Ebola virus) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MRRGVLPTAPPAYNDIAYPMSILPTRPSVIVNETKSDVLAVPGADVPSNSMRPVADDNIDHSSHTPSGVASAFILEATVNVISGTKVLMKQIPIWLPLGVADQKIYSFDSTTAAIMLASYTVTHFGKISNPLVRVNRLGPGIPDHPLRLLRLGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDETPAGAVNALRPGLSLHPKLRPILLPGKTGKKGHASDLTSPDKIQTIMNAIPDLKIVPIDPT |
| Anwendungsbeschreibung: | Biological Origin: Reston ebolavirus (strain Reston-89) (REBOV) (Reston Ebola virus). Application Notes: N-terminal 10xHis-GST-tagged: N-terminal 6xHis-SUMO-tagged27-96AA: 1-331AAFull Length of Mature Protein: Full Length |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Reston ebolavirus (strain Reston-89) (REBOV) (Reston Ebola virus) VP40. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Reston ebolavirus (strain Reston-89) (REBOV) (Reston Ebola virus) VP40. |
Produktgarantie und fachkundiger Support
