Bovine PAG1 protein

Artikelnummer: BYT-ORB54203
Artikelname: Bovine PAG1 protein
Artikelnummer: BYT-ORB54203
Hersteller Artikelnummer: orb54203
Alternativnummer: BYT-ORB54203-20,BYT-ORB54203-100,BYT-ORB54203-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Pregnancy-specific protein B Short name, PSP-B
This Bovine PAG1 protein spans the amino acid sequence from region 54-380aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 40.7 kDa
UniProt: Q29432
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Bos taurus (Bovine)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RGSNLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFRLTNKTFRITYGSGRMKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDKLKNQRAISEPVFAFYLSKDEREGSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCKALVDTGTSDIVGPRRLVNNIHRLIGAIPRGSEHYVPCSEVNT
Anwendungsbeschreibung: Biological Origin: Bos taurus (Bovine). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-tagged44-261AA: 54-380AAExtracellular Domain: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) PAG1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) PAG1.