Human LSP1 protein
Artikelnummer:
BYT-ORB54220
- Bilder (3)
| Artikelname: | Human LSP1 protein |
| Artikelnummer: | BYT-ORB54220 |
| Hersteller Artikelnummer: | orb54220 |
| Alternativnummer: | BYT-ORB54220-20,BYT-ORB54220-100,BYT-ORB54220-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | 47KDA actin-binding protein 52KDA phosphoprotein |
| This Human LSP1 protein spans the amino acid sequence from region 1-339aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 64.2 kDa |
| UniProt: | P33241 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGTLDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIEL |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-198AA: 1-339AAFull Length : Full Length of BC001785 |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) LSP1. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) LSP1. |
Produktgarantie und fachkundiger Support
