Human TOMM40 protein

Artikelnummer: BYT-ORB54371
Artikelname: Human TOMM40 protein
Artikelnummer: BYT-ORB54371
Hersteller Artikelnummer: orb54371
Alternativnummer: BYT-ORB54371-20,BYT-ORB54371-100,BYT-ORB54371-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Protein Haymaker Translocase of outer membrane 40KDA subunit homolog p38.5
This Human TOMM40 protein spans the amino acid sequence from region 1-361aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 64.9 kDa
UniProt: O96008
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYT
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-352AA: 1-361AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TOMM40.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TOMM40.