Human HAND2 protein

Artikelnummer: BYT-ORB54396
Artikelname: Human HAND2 protein
Artikelnummer: BYT-ORB54396
Hersteller Artikelnummer: orb54396
Alternativnummer: BYT-ORB54396-20,BYT-ORB54396-100,BYT-ORB54396-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Class A basic helix-loop-helix protein 26
This Human HAND2 protein spans the amino acid sequence from region 1-180aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 47.3 kDa
UniProt: P61296
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-217AA: 1-180AAFull Length : Full Length of Isoform 2
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.