Human PDXK protein

Artikelnummer: BYT-ORB54404
Artikelname: Human PDXK protein
Artikelnummer: BYT-ORB54404
Hersteller Artikelnummer: orb54404
Alternativnummer: BYT-ORB54404-20,BYT-ORB54404-100,BYT-ORB54404-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Pyridoxine kinase
This Human PDXK protein spans the amino acid sequence from region 1-312aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 62.1 kDa
UniProt: O00764
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-325AA: 1-312AAFull Length of BC005341 : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.