Human BLVRA protein

Artikelnummer: BYT-ORB54412
Artikelname: Human BLVRA protein
Artikelnummer: BYT-ORB54412
Hersteller Artikelnummer: orb54412
Alternativnummer: BYT-ORB54412-20,BYT-ORB54412-100,BYT-ORB54412-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Biliverdin-IX alpha-reductase
This Human BLVRA protein spans the amino acid sequence from region 1-296aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 60.4 kDa
UniProt: P53004
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-345AA: 1-296AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.