Human FGF14 protein

Artikelnummer: BYT-ORB54414
Artikelname: Human FGF14 protein
Artikelnummer: BYT-ORB54414
Hersteller Artikelnummer: orb54414
Alternativnummer: BYT-ORB54414-20,BYT-ORB54414-100,BYT-ORB54414-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Fibroblast growth factor homologous factor 4
This Human FGF14 protein spans the amino acid sequence from region 1-252aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 55.5 kDa
UniProt: Q92915
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-368AA: 1-252AAFull Length of Isoform 2 : Full Length of Isoform 2
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.