Human CDKN2D protein

Artikelnummer: BYT-ORB54418
Artikelname: Human CDKN2D protein
Artikelnummer: BYT-ORB54418
Hersteller Artikelnummer: orb54418
Alternativnummer: BYT-ORB54418-20,BYT-ORB54418-100,BYT-ORB54418-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: p19-INK4d
This Human CDKN2D protein spans the amino acid sequence from region 1-166aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 44.7 kDa
UniProt: P55273
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-93AA: 1-166AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.