Human MPI protein

Artikelnummer: BYT-ORB54434
Artikelname: Human MPI protein
Artikelnummer: BYT-ORB54434
Hersteller Artikelnummer: orb54434
Alternativnummer: BYT-ORB54434-20,BYT-ORB54434-100,BYT-ORB54434-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Phosphohexomutase Phosphomannose isomerase
This Human MPI protein spans the amino acid sequence from region 1-423aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 73.5 kDa
UniProt: P34949
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-195AA: 1-423AAFull Length of BC066915 : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.