Human NUDT2 protein

Artikelnummer: BYT-ORB54454
Artikelname: Human NUDT2 protein
Artikelnummer: BYT-ORB54454
Hersteller Artikelnummer: orb54454
Alternativnummer: BYT-ORB54454-20,BYT-ORB54454-100,BYT-ORB54454-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Diadenosine 5,5-P1,P4-tetraphosphate asymmetrical hydrolase
This Human NUDT2 protein spans the amino acid sequence from region 1-147aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 43.8 kDa
UniProt: P50583
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-166AA: 1-147AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.