Human TRIM69 protein

Artikelnummer: BYT-ORB54457
Artikelname: Human TRIM69 protein
Artikelnummer: BYT-ORB54457
Hersteller Artikelnummer: orb54457
Alternativnummer: BYT-ORB54457-20,BYT-ORB54457-100,BYT-ORB54457-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: RFP-like domain-containing protein trimless RING finger protein 36 Tripartite motif-containing protein 69
This Human TRIM69 protein spans the amino acid sequence from region 1-341aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 66.3 kDa
UniProt: Q86WT6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEEELAIQQGQLETTLKELQTLRNMQKEAIAAHKENKLHLQQHVSMEFLKLHQFLHSKEKDILTELREEGKALNEEMELNLSQLQEQCLLAKDMLVSIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLGQYKGPIQYMVWREMQDTLCPGLSPLTLDPKTAHPNLVLSKSQTSVWHGDIKKIMPDDPERFDSSVAVLGSRGFTSGKWYWEVEVAKKTKWTVGVVRESIIRKGSCPLTPEQGFW
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-76AA: 1-341AAFull Length : Full Length of Isoform 2
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.