Human LMO4 protein

Artikelnummer: BYT-ORB54462
Artikelname: Human LMO4 protein
Artikelnummer: BYT-ORB54462
Hersteller Artikelnummer: orb54462
Alternativnummer: BYT-ORB54462-20,BYT-ORB54462-100,BYT-ORB54462-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Breast tumor autoantigen LIM domain only protein 4
This Human LMO4 protein spans the amino acid sequence from region 1-165aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 45 kDa
UniProt: P61968
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-108AA: 1-165AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.