Human GABARAPL1 protein

Artikelnummer: BYT-ORB54464
Artikelname: Human GABARAPL1 protein
Artikelnummer: BYT-ORB54464
Hersteller Artikelnummer: orb54464
Alternativnummer: BYT-ORB54464-20,BYT-ORB54464-100,BYT-ORB54464-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Early estrogen-regulated protein GABA(A) receptor-associated protein-like 1 Glandular epithelial cell protein 1
This Human GABARAPL1 protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 41.0 kDa
UniProt: Q9H0R8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-358AA: 1-117AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.