Human GTF2A2 protein

Artikelnummer: BYT-ORB54465
Artikelname: Human GTF2A2 protein
Artikelnummer: BYT-ORB54465
Hersteller Artikelnummer: orb54465
Alternativnummer: BYT-ORB54465-20,BYT-ORB54465-100,BYT-ORB54465-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: General transcription factor IIA subunit 2 TFIIA p12 subunit
This Human GTF2A2 protein spans the amino acid sequence from region 1-109aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 39.5 kDa
UniProt: P52657
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-117AA: 1-109AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.