Human SNAP29 protein

Artikelnummer: BYT-ORB54507
Artikelname: Human SNAP29 protein
Artikelnummer: BYT-ORB54507
Hersteller Artikelnummer: orb54507
Alternativnummer: BYT-ORB54507-20,BYT-ORB54507-100,BYT-ORB54507-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Soluble 29KDA NSF attachment protein Vesicle-membrane fusion protein SNAP-29
This Human SNAP29 protein spans the amino acid sequence from region 1-258aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 56 kDa
UniProt: O95721
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-225AA: 1-258AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.