Human GNB1L protein

Artikelnummer: BYT-ORB54510
Artikelname: Human GNB1L protein
Artikelnummer: BYT-ORB54510
Hersteller Artikelnummer: orb54510
Alternativnummer: BYT-ORB54510-20,BYT-ORB54510-100,BYT-ORB54510-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: DGCRK3 WD repeat-containing protein 14 WD40 repeat-containing protein deleted in VCFS
This Human GNB1L protein spans the amino acid sequence from region 1-327aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 62.6 kDa
UniProt: Q9BYB4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAVTTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPG
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-178AA: 1-327AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.