Human MSRB3 protein

Artikelnummer: BYT-ORB54511
Artikelname: Human MSRB3 protein
Artikelnummer: BYT-ORB54511
Hersteller Artikelnummer: orb54511
Alternativnummer: BYT-ORB54511-20,BYT-ORB54511-100,BYT-ORB54511-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Deafness, Autosomal Recessive 74, DFNB74, FLJ36866, Methionine R sulfoxide reductase B mitochondrial, Methionine sulfoxide reductase B3, Methionine-R-sulfoxide reductase B3, MsrB3, MSRB3_HUMAN
This Human MSRB3 protein spans the amino acid sequence from region 1-185aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 47 kDa
UniProt: Q8IXL7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-327AA: 1-185AAFull Length : Full Length of Isoform 2
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.