Human CETN1 protein

Artikelnummer: BYT-ORB54516
Artikelname: Human CETN1 protein
Artikelnummer: BYT-ORB54516
Hersteller Artikelnummer: orb54516
Alternativnummer: BYT-ORB54516-20,BYT-ORB54516-100,BYT-ORB54516-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Caltractin isoform 2
This Human CETN1 protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 46.6 kDa
UniProt: Q12798
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-269AA: 1-172AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.