Human DSN1 protein

Artikelnummer: BYT-ORB54519
Artikelname: Human DSN1 protein
Artikelnummer: BYT-ORB54519
Hersteller Artikelnummer: orb54519
Alternativnummer: BYT-ORB54519-20,BYT-ORB54519-100,BYT-ORB54519-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: C20orf172, Chromosome 20 open reading frame 172, dJ469A13.2, DSN1, DSN1, MIND kinetochore complex component, homolog, DSN1, MIND kinetochore complex component, homolog (S. cerevisiae), DSN1, MIS12 kinetochore complex component, DSN1_HUMAN, FLJ13346, hKNL-3, Kinetochore associated protein DSN1, Kinetochore associated protein DSN1 homolog, Kinetochore null 3 homolog, Kinetochore-associated protein DSN1 homolog, KNL3, MGC32987, MIS13
This Human DSN1 protein spans the amino acid sequence from region 1-356aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 67.1 kDa
UniProt: Q9H410
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MTSVTRSEIIDEKGPVMSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSEERIHLGSSPKKGGNCDLSHQERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKASDFSLEASVAEMKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-190AA: 1-356AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.