Human MRPS22 protein

Artikelnummer: BYT-ORB54524
Artikelname: Human MRPS22 protein
Artikelnummer: BYT-ORB54524
Hersteller Artikelnummer: orb54524
Alternativnummer: BYT-ORB54524-20,BYT-ORB54524-100,BYT-ORB54524-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 28S ribosomal protein S22, C3orf5, COXPD5, GIBT, GK002, mitochondrial, Mitochondrial ribosomal protein S22, MRP-S22, MRPS22, RPM S22, RPMS22, RT22_HUMAN, S22mt
This Human MRPS22 protein spans the amino acid sequence from region 1-360aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 68.3 kDa
UniProt: P82650
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-169AA: 1-360AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.