Human TIMM17B protein

Artikelnummer: BYT-ORB54534
Artikelname: Human TIMM17B protein
Artikelnummer: BYT-ORB54534
Hersteller Artikelnummer: orb54534
Alternativnummer: BYT-ORB54534-20,BYT-ORB54534-100,BYT-ORB54534-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: DXS9822, Inner mitochondrial membrane preprotein translocase, JM3, Mitochondrial import inner membrane translocase subunit Tim17-B, TI17B_HUMAN, Tim17b, TIMM17B, Translocase of inner mitochondrial membrane 17 homolog B (yeast)
This Human TIMM17B protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 45.3 kDa
UniProt: O60830
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-150AA: 1-172AAFull Length of Isoform MLC3: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.