Viral VACWR074 protein

Artikelnummer: BYT-ORB54666
Artikelname: Viral VACWR074 protein
Artikelnummer: BYT-ORB54666
Hersteller Artikelnummer: orb54666
Alternativnummer: BYT-ORB54666-20,BYT-ORB54666-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Protein VP13K
This Viral VACWR074 protein spans the amino acid sequence from region 2-79aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 24.6 kDa
UniProt: P12924
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS
Anwendungsbeschreibung: Biological Origin: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-SUMO-tagged1-231AA: 2-79AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.