human KCNJ10 protein

Artikelnummer: BYT-ORB54667
Artikelname: human KCNJ10 protein
Artikelnummer: BYT-ORB54667
Hersteller Artikelnummer: orb54667
Alternativnummer: BYT-ORB54667-20,BYT-ORB54667-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ATP-dependent inwardly rectifying potassium channel Kir4.1 Inward rectifier K(+) channel Kir1.2 Potassium channel, inwardly rectifying subfamily J member 10
This human KCNJ10 protein spans the amino acid sequence from region 1-379aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 58.5 kDa
UniProt: P78508
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged2-79AA: 1-379AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.