Viral M2 protein

Artikelnummer: BYT-ORB54676
Artikelname: Viral M2 protein
Artikelnummer: BYT-ORB54676
Hersteller Artikelnummer: orb54676
Alternativnummer: BYT-ORB54676-20,BYT-ORB54676-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: M, M2, Matrix protein 2, Proton channel protein M2
This Viral M2 protein spans the amino acid sequence from region 1-97aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 15.1 kDa
UniProt: A4GCM0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Influenza A virus (strain A/USA:Phila/1935 H1N1)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE
Anwendungsbeschreibung: Biological Origin: Influenza A virus (strain A/USA:Phila/1935 H1N1). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-tagged1-181AA: 1-97AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.