Human HTR3E protein

Artikelnummer: BYT-ORB54692
Artikelname: Human HTR3E protein
Artikelnummer: BYT-ORB54692
Hersteller Artikelnummer: orb54692
Alternativnummer: BYT-ORB54692-20,BYT-ORB54692-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Serotonin receptor 3E
This Human HTR3E protein spans the amino acid sequence from region 72-228aa&241-456aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 58.2 kDa
UniProt: A5X5Y0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVAT
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged38-693AA: 72-228AA&241-456AAPartial: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.