Human DCP1B protein

Artikelnummer: BYT-ORB54707
Artikelname: Human DCP1B protein
Artikelnummer: BYT-ORB54707
Hersteller Artikelnummer: orb54707
Alternativnummer: BYT-ORB54707-20,BYT-ORB54707-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: DCP 1B, DCP1, DCP1 decapping enzyme homolog B, DCP1B, DCP1B_HUMAN, Decapping enzyme Dcp1b, Decapping enzyme hDcp1b, Decapping enzyme homolog B (S. cerevisiae), Decapping mRNA 1B, hDcp1b, mRNA decapping enzyme 1B, mRNA-decapping enzyme 1B
This Human DCP1B protein spans the amino acid sequence from region 2-617aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 81.6 kDa
UniProt: Q8IZD4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEWEKTDVEGTLFVYTRSASPKHGFTIMNRLSMENRTEPITKDLDFQLQDPFLLYRNARLSIYGIWFYDKEECQRIAELMKNLTQYEQLKAHQGTGAGISPVILNSGEGKEVDILRMLIKAKDEYTKCKTCSEPKKITSSSAIYDNPNLIKPIPVKPSENQQQRIPQPNQTLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-B2M-tagged: N-terminal 6xHis-B2M-tagged1-300AA: 2-617AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.