Dog Anionic trypsin protein

Artikelnummer: BYT-ORB54711
Artikelname: Dog Anionic trypsin protein
Artikelnummer: BYT-ORB54711
Hersteller Artikelnummer: orb54711
Alternativnummer: BYT-ORB54711-20,BYT-ORB54711-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Anionic trypsin, EC 3.4.21.4
This Dog Anionic trypsin protein spans the amino acid sequence from region 24-247aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 40 kDa
UniProt: P06872
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Canis lupus familiaris (Dog) (Canis familiaris)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLNARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQITENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQSTIAANS
Anwendungsbeschreibung: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: N-terminal 6xHis-B2M-tagged: N-terminal 6xHis-SUMO-tagged1-391AA: 24-247AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.