Human IL7 protein

Artikelnummer: BYT-ORB54713
Artikelname: Human IL7 protein
Artikelnummer: BYT-ORB54713
Hersteller Artikelnummer: orb54713
Alternativnummer: BYT-ORB54713-20,BYT-ORB54713-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: IL 7, IL-7, Il7, IL7_HUMAN, Interleukin 7, Interleukin-7, LP-1, Lymphopoietin 1
This Human IL7 protein spans the amino acid sequence from region 26-177aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 33.4 kDa
UniProt: P13232
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged24-246AA: 26-177AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.