Mouse Asah1 protein

Artikelnummer: BYT-ORB54734
Artikelname: Mouse Asah1 protein
Artikelnummer: BYT-ORB54734
Hersteller Artikelnummer: orb54734
Alternativnummer: BYT-ORB54734-20,BYT-ORB54734-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Acylsphingosine deacylase N-acylsphingosine amidohydrolase
This Mouse Asah1 protein spans the amino acid sequence from region 19-141aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 33.8 kDa
UniProt: Q9WV54
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: N-terminal 6xHis-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged18-279AA: 19-141AAExtracellular Domain: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.