Mouse Galc protein

Artikelnummer: BYT-ORB54737
Artikelname: Mouse Galc protein
Artikelnummer: BYT-ORB54737
Hersteller Artikelnummer: orb54737
Alternativnummer: BYT-ORB54737-20,BYT-ORB54737-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Galactocerebroside beta-galactosidase Galactosylceramidase Galactosylceramide beta-galactosidase
This Mouse Galc protein spans the amino acid sequence from region 43-684aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 73.1 kDa
UniProt: P54818
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYI
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: NO-tagged26-638AA: 43-684AAExtracellular Domain: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.