Bacterial rplV protein

Artikelnummer: BYT-ORB54744
Artikelname: Bacterial rplV protein
Artikelnummer: BYT-ORB54744
Hersteller Artikelnummer: orb54744
Alternativnummer: BYT-ORB54744-20,BYT-ORB54744-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: rplV, APH_0285, 50S ribosomal protein L22
This Bacterial rplV protein spans the amino acid sequence from region 1-112aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 32.2 kDa
UniProt: Q2GL54
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Anaplasma phagocytophilum (strain HZ)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER
Anwendungsbeschreibung: Biological Origin: Anaplasma phagocytophilum (strain HZ). Application Notes: NO-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged1-712AA: 1-112AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.