Plant Avena sativa Endochitinase protein

Artikelnummer: BYT-ORB54761
Artikelname: Plant Avena sativa Endochitinase protein
Artikelnummer: BYT-ORB54761
Hersteller Artikelnummer: orb54761
Alternativnummer: BYT-ORB54761-20,BYT-ORB54761-100,BYT-ORB54761-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Endochitinase, EC 3.2.1.14, Fragments
This Plant Avena sativa Endochitinase protein spans the amino acid sequence from region 1-200aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 25.7 kDa
UniProt: P86181
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Avena sativa (Oat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA
Anwendungsbeschreibung: Biological Origin: Avena sativa (Oat). Application Notes: N-terminal 10xHis-tagged and C-terminal Myc-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged1-214AA: 1-200AAFull Length: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.