CY24B Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB55682
Artikelname: CY24B Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB55682
Hersteller Artikelnummer: orb55682
Alternativnummer: BYT-ORB55682-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CY24B
Konjugation: Unconjugated
Alternative Synonym: CGD, NOX2, IMD34, AMCBX2, GP91-1, GP91PHOX, p91-PHOX, GP91-PHOX
Rabbit polyclonal antibody to CY24B.
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 62 kDa
NCBI: 000388
UniProt: P04839
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: YGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRG
Target-Kategorie: CYBB
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment.
Sample Tissue: HepG2 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.
IHC Information: Lung, Human: Formalin-Fixed, Paraffin-Embedded (FFPE).
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.